PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj3g3v3752130.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NAC
Protein Properties Length: 372aa    MW: 42688.7 Da    PI: 7.4014
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj3g3v3752130.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.51.3e-53161451129
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                      +ppGfrFhPtdeel+++yLkkkv+ +k+++ +vi+evd++k+ePwdL++++k     ++ewyfFs++d+ky+tg+r+nrat++g+Wkatg+dk 
  Lj3g3v3752130.1  16 VPPGFRFHPTDEELLHYYLKKKVSFQKFDM-DVIREVDLNKMEPWDLQERCKIgstPQNEWYFFSHKDRKYPTGSRTNRATNAGFWKATGRDKC 108
                      69****************************.99**************964444222455*********************************** PP

              NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                      + + +  ++g++ktLvfykgrap+g+ktdW+mheyrle
  Lj3g3v3752130.1 109 IRN-SYMKIGMRKTLVFYKGRAPHGQKTDWIMHEYRLE 145
                      **9.8999****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.24E-607167IPR003441NAC domain
PROSITE profilePS5100557.94616167IPR003441NAC domain
PfamPF023658.5E-2817144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048829Biological Processroot cap development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MVALTTMKMA SSNGGVPPGF RFHPTDEELL HYYLKKKVSF QKFDMDVIRE VDLNKMEPWD  60
LQERCKIGST PQNEWYFFSH KDRKYPTGSR TNRATNAGFW KATGRDKCIR NSYMKIGMRK  120
TLVFYKGRAP HGQKTDWIMH EYRLEDANDP EGNTNEDGWV VCRVFKKKNL FKIGNNEGSS  180
AHNSEQPINN SSGANARSFM HRDNQYLLLQ QQNTRNPSGF ELDKPELGLH HYPHLQNQPQ  240
YALFQSQQPL LQSHKPMVYN DYSYASSLPS DPPLKQLMTN PRDCESGSDG LRYQVSESGM  300
EVGSCEPPQE MGGGRGEGMN EWGVLDRLVT SHLGNEDSTK EVRFDDANPQ SVHQINQLSL  360
RGEMDFWGYA KQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B3e-531616917167NAC domain-containing protein 19
4dul_A3e-531616917167NAC domain-containing protein 19
1ut7_B3e-531616917167NO APICAL MERISTEM PROTEIN
1ut7_A3e-531616917167NO APICAL MERISTEM PROTEIN
1ut4_B3e-531616917167NO APICAL MERISTEM PROTEIN
1ut4_A3e-531616917167NO APICAL MERISTEM PROTEIN
3swp_D3e-531616920170NAC domain-containing protein 19
3swp_C3e-531616920170NAC domain-containing protein 19
3swp_B3e-531616920170NAC domain-containing protein 19
3swp_A3e-531616920170NAC domain-containing protein 19
3swm_D3e-531616920170NAC domain-containing protein 19
3swm_C3e-531616920170NAC domain-containing protein 19
3swm_B3e-531616920170NAC domain-containing protein 19
3swm_A3e-531616920170NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00431DAPTransfer from AT4G10350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150399e-81AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014493688.10.0PREDICTED: protein BEARSKIN2-like
SwissprotQ9SV871e-156BRN2_ARATH; Protein BEARSKIN2
TrEMBLA0A0L9V9I30.0A0A0L9V9I3_PHAAN; Uncharacterized protein
TrEMBLA0A0S3SEU20.0A0A0S3SEU2_PHAAN; Uncharacterized protein
STRINGGLYMA12G00540.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87523343
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G10350.11e-152NAC domain containing protein 70